SCOPe 2.07: Domain d2cxba_: 2cxb A:

Lineage for d2cxba_ (2cxb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)

8. Domain d2cxba_: 2cxb A: [15891]
   complexed with hem

Details for d2cxba_

PDB Entry: 2cxb, 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d2cxba_:

Sequence; same for both SEQRES and ATOM records:

>d2cxba_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

Timeline for d2cxba_:

• d2cxba_ first appeared (with stable ids) in SCOP 1.55
  
• d2cxba_ appears in SCOPe 2.06