Lineage for d1cxc__ (1cxc -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94595Protein Cytochrome c2 [46650] (8 species)
  7. 94603Species Rhodobacter sphaeroides [TaxId:1063] [46653] (3 PDB entries)
  8. 94604Domain d1cxc__: 1cxc - [15890]

Details for d1cxc__

PDB Entry: 1cxc (more details), 1.6 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d1cxc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxc__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1cxc__:

Click to download the PDB-style file with coordinates for d1cxc__.
(The format of our PDB-style files is described here.)

Timeline for d1cxc__: