Lineage for d1cxc__ (1cxc -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 protein domains)
  6. 988Protein Cytochrome c2 [46650] (7 species)
  7. 996Species Rhodobacter sphaeroides [TaxId:1063] [46653] (3 PDB entries)
  8. 997Domain d1cxc__: 1cxc - [15890]

Details for d1cxc__

PDB Entry: 1cxc (more details), 1.6 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d1cxc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxc__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1cxc__:

Click to download the PDB-style file with coordinates for d1cxc__.
(The format of our PDB-style files is described here.)

Timeline for d1cxc__: