Lineage for d1c2n__ (1c2n -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45018Species Rhodobacter capsulatus [TaxId:1061] [46652] (2 PDB entries)
  8. 45021Domain d1c2n__: 1c2n - [15889]

Details for d1c2n__

PDB Entry: 1c2n (more details)

PDB Description: cytochrome c2, nmr, 20 structures

SCOP Domain Sequences for d1c2n__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2n__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk

SCOP Domain Coordinates for d1c2n__:

Click to download the PDB-style file with coordinates for d1c2n__.
(The format of our PDB-style files is described here.)

Timeline for d1c2n__: