Lineage for d1c2rb_ (1c2r B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45018Species Rhodobacter capsulatus [TaxId:1061] [46652] (2 PDB entries)
  8. 45020Domain d1c2rb_: 1c2r B: [15888]

Details for d1c2rb_

PDB Entry: 1c2r (more details), 2.5 Å

PDB Description: molecular structure of cytochrome c2 isolated from rhodobacter capsulatus determined at 2.5 angstroms resolution

SCOP Domain Sequences for d1c2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2rb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk

SCOP Domain Coordinates for d1c2rb_:

Click to download the PDB-style file with coordinates for d1c2rb_.
(The format of our PDB-style files is described here.)

Timeline for d1c2rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c2ra_