Lineage for d1c2ra_ (1c2r A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 988Protein Cytochrome c2 [46650] (7 species)
  7. 992Species Rhodobacter capsulatus [TaxId:1061] [46652] (2 PDB entries)
  8. 993Domain d1c2ra_: 1c2r A: [15887]

Details for d1c2ra_

PDB Entry: 1c2r (more details), 2.5 Å

PDB Description: molecular structure of cytochrome c2 isolated from rhodobacter capsulatus determined at 2.5 angstroms resolution

SCOP Domain Sequences for d1c2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ra_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk

SCOP Domain Coordinates for d1c2ra_:

Click to download the PDB-style file with coordinates for d1c2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1c2ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c2rb_