SCOPe 2.08: Domain d1c2ra_: 1c2r A:

Lineage for d1c2ra_ (1c2r A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
   Uniprot P00094

8. Domain d1c2ra_: 1c2r A: [15887]
   complexed with hec

Details for d1c2ra_

PDB Entry: 1c2r, 2.5 Å

PDB Description: molecular structure of cytochrome c2 isolated from rhodobacter capsulatus determined at 2.5 angstroms resolution

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1c2ra_:

Sequence; same for both SEQRES and ATOM records:

>d1c2ra_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter capsulatus [TaxId: 1061]}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk

Timeline for d1c2ra_:

• d1c2ra_ first appeared (with stable ids) in SCOP 1.55
  
• d1c2ra_ appears in SCOPe 2.07