Lineage for d2c2c__ (2c2c -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45041Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries)
  8. 45043Domain d2c2c__: 2c2c - [15886]

Details for d2c2c__

PDB Entry: 2c2c (more details), 2 Å

PDB Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2

SCOP Domain Sequences for d2c2c__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2c__ a.3.1.1 (-) Cytochrome c2 {Rhodospirillum rubrum}
egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk

SCOP Domain Coordinates for d2c2c__:

Click to download the PDB-style file with coordinates for d2c2c__.
(The format of our PDB-style files is described here.)

Timeline for d2c2c__: