Lineage for d2c2c__ (2c2c -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries) 
Domain d2c2c__: 2c2c - [15886]
Details for d2c2c__
PDB Entry: 2c2c (more details), 2 Å
PDB Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2
SCOP Domain Sequences for d2c2c__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2c__ a.3.1.1 (-) Cytochrome c2 {Rhodospirillum rubrum}
egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk
SCOP Domain Coordinates for d2c2c__:
Click to download the PDB-style file with coordinates for d2c2c__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c2c__:
- d2c2c__ appears in SCOP 1.57
- d2c2c__ appears in the current release, SCOPe 2.07, called d2c2ca_
View in 3D