Lineage for d2c2ca_ (2c2c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690847Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries)
  8. 2690849Domain d2c2ca_: 2c2c A: [15886]
    complexed with hec

Details for d2c2ca_

PDB Entry: 2c2c (more details), 2 Å

PDB Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d2c2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2ca_ a.3.1.1 (A:) Cytochrome c2 {Rhodospirillum rubrum [TaxId: 1085]}
egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk

SCOPe Domain Coordinates for d2c2ca_:

Click to download the PDB-style file with coordinates for d2c2ca_.
(The format of our PDB-style files is described here.)

Timeline for d2c2ca_: