SCOPe 2.06: Domain d3c2ca_: 3c2c A:

Lineage for d3c2ca_ (3c2c A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries)

8. Domain d3c2ca_: 3c2c A: [15885]
   complexed with hem

Details for d3c2ca_

PDB Entry: 3c2c, 1.68 Å

PDB Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d3c2ca_:

Sequence; same for both SEQRES and ATOM records:

>d3c2ca_ a.3.1.1 (A:) Cytochrome c2 {Rhodospirillum rubrum [TaxId: 1085]}
egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk

Timeline for d3c2ca_:

• d3c2ca_ first appeared (with stable ids) in SCOP 1.55, called d3c2c__
  
• d3c2ca_ appears in SCOPe 2.05
  
• d3c2ca_ appears in SCOPe 2.07
  
• d3c2ca_ appears in the current release, SCOPe 2.08