Lineage for d3c2c__ (3c2c -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 988Protein Cytochrome c2 [46650] (7 species)
  7. 1009Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries)
  8. 1010Domain d3c2c__: 3c2c - [15885]

Details for d3c2c__

PDB Entry: 3c2c (more details), 1.68 Å

PDB Description: refinement of the crystal structure of oxidized rhodospirillum rubrum cytochrome c2

SCOP Domain Sequences for d3c2c__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2c__ a.3.1.1 (-) Cytochrome c2 {Rhodospirillum rubrum}
egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk

SCOP Domain Coordinates for d3c2c__:

Click to download the PDB-style file with coordinates for d3c2c__.
(The format of our PDB-style files is described here.)

Timeline for d3c2c__: