Lineage for d1qn2c_ (1qn2 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691031Protein Cytochrome ch [46648] (1 species)
  7. 2691032Species Methylobacterium extorquens [TaxId:408] [46649] (1 PDB entry)
  8. 2691035Domain d1qn2c_: 1qn2 C: [15884]
    complexed with hec

Details for d1qn2c_

PDB Entry: 1qn2 (more details), 2.01 Å

PDB Description: cytochrome ch from methylobacterium extorquens
PDB Compounds: (C:) cytochrome ch

SCOPe Domain Sequences for d1qn2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qn2c_ a.3.1.1 (C:) Cytochrome ch {Methylobacterium extorquens [TaxId: 408]}
gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk

SCOPe Domain Coordinates for d1qn2c_:

Click to download the PDB-style file with coordinates for d1qn2c_.
(The format of our PDB-style files is described here.)

Timeline for d1qn2c_: