Lineage for d1qn2b_ (1qn2 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 210020Protein Cytochrome ch [46648] (1 species)
  7. 210021Species Methylobacterium extorquens [TaxId:408] [46649] (1 PDB entry)
  8. 210023Domain d1qn2b_: 1qn2 B: [15883]

Details for d1qn2b_

PDB Entry: 1qn2 (more details), 2.01 Å

PDB Description: cytochrome ch from methylobacterium extorquens

SCOP Domain Sequences for d1qn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qn2b_ a.3.1.1 (B:) Cytochrome ch {Methylobacterium extorquens}
gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk

SCOP Domain Coordinates for d1qn2b_:

Click to download the PDB-style file with coordinates for d1qn2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qn2b_: