![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome ch [46648] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [46649] (1 PDB entry) |
![]() | Domain d1qn2b_: 1qn2 B: [15883] complexed with hec |
PDB Entry: 1qn2 (more details), 2.01 Å
SCOPe Domain Sequences for d1qn2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qn2b_ a.3.1.1 (B:) Cytochrome ch {Methylobacterium extorquens [TaxId: 408]} gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk
Timeline for d1qn2b_: