Lineage for d3cyti_ (3cyt I:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304629Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
    identical sequence to Thunnus alalunga, TaxId: 8235
  8. 2304637Domain d3cyti_: 3cyt I: [15880]
    complexed with hem

Details for d3cyti_

PDB Entry: 3cyt (more details), 1.8 Å

PDB Description: redox conformation changes in refined tuna cytochrome c
PDB Compounds: (I:) cytochrome c

SCOPe Domain Sequences for d3cyti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyti_ a.3.1.1 (I:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOPe Domain Coordinates for d3cyti_:

Click to download the PDB-style file with coordinates for d3cyti_.
(The format of our PDB-style files is described here.)

Timeline for d3cyti_: