SCOP 1.73: Domain d3cyti_: 3cyt I:

Lineage for d3cyti_ (3cyt I:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
   identical sequence to Thunnus alalunga, TaxId: 8235

8. Domain d3cyti_: 3cyt I: [15880]
   complexed with hem

Details for d3cyti_

PDB Entry: 3cyt, 1.8 Å

PDB Description: redox conformation changes in refined tuna cytochrome c

PDB Compounds: (I:) cytochrome c

SCOP Domain Sequences for d3cyti_:

Sequence; same for both SEQRES and ATOM records:

>d3cyti_ a.3.1.1 (I:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d3cyti_:

• d3cyti_ first appeared (with stable ids) in SCOP 1.55
  
• d3cyti_ appears in SCOP 1.71
  
• d3cyti_ appears in SCOP 1.75
  
• d3cyti_ appears in the current release, SCOPe 2.08