Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries) identical sequence to Thunnus alalunga, TaxId: 8235 |
Domain d3cyto_: 3cyt O: [15879] complexed with hem |
PDB Entry: 3cyt (more details), 1.8 Å
SCOPe Domain Sequences for d3cyto_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cyto_ a.3.1.1 (O:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
Timeline for d3cyto_: