Lineage for d3cyto_ (3cyt O:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760825Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 760875Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
    identical sequence to Thunnus alalunga, TaxId: 8235
  8. 760884Domain d3cyto_: 3cyt O: [15879]

Details for d3cyto_

PDB Entry: 3cyt (more details), 1.8 Å

PDB Description: redox conformation changes in refined tuna cytochrome c
PDB Compounds: (O:) cytochrome c

SCOP Domain Sequences for d3cyto_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyto_ a.3.1.1 (O:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d3cyto_:

Click to download the PDB-style file with coordinates for d3cyto_.
(The format of our PDB-style files is described here.)

Timeline for d3cyto_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cyti_