Lineage for d3cyto_ (3cyt O:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Mitochondrial cytochrome c [46642] (5 species) 
Species Albacore tuna (Thunnus alalunga) [46646] (2 PDB entries) 
Domain d3cyto_: 3cyt O: [15879]
Details for d3cyto_
PDB Entry: 3cyt (more details), 1.8 Å
PDB Description: redox conformation changes in refined tuna cytochrome c
SCOP Domain Sequences for d3cyto_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cyto_ a.3.1.1 (O:) Mitochondrial cytochrome c {Albacore tuna (Thunnus alalunga)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
SCOP Domain Coordinates for d3cyto_:
Click to download the PDB-style file with coordinates for d3cyto_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cyto_:
- d3cyto_ appears in SCOP 1.57
- d3cyto_ appears in the current release, SCOPe 2.08
View in 3D
