SCOPe 2.08: Domain d3cyto_: 3cyt O:

Lineage for d3cyto_ (3cyt O:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
   identical sequence to Thunnus alalunga, TaxId: 8235

8. Domain d3cyto_: 3cyt O: [15879]
   complexed with hec

Details for d3cyto_

PDB Entry: 3cyt, 1.8 Å

PDB Description: redox conformation changes in refined tuna cytochrome c

PDB Compounds: (O:) cytochrome c

SCOPe Domain Sequences for d3cyto_:

Sequence; same for both SEQRES and ATOM records:

>d3cyto_ a.3.1.1 (O:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d3cyto_:

• d3cyto_ first appeared (with stable ids) in SCOP 1.55
  
• d3cyto_ appears in SCOPe 2.07