Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries) identical sequence to Thunnus alalunga, TaxId: 8235 |
Domain d5cytr_: 5cyt R: [15878] complexed with hem |
PDB Entry: 5cyt (more details), 1.5 Å
SCOP Domain Sequences for d5cytr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cytr_ a.3.1.1 (R:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
Timeline for d5cytr_: