Lineage for d1ccr__ (1ccr -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94716Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 94765Species Rice embryos (Oryza sativa) [TaxId:4530] [46645] (1 PDB entry)
  8. 94766Domain d1ccr__: 1ccr - [15877]

Details for d1ccr__

PDB Entry: 1ccr (more details), 1.5 Å

PDB Description: structure of rice ferricytochrome c at 2.0 angstroms resolution

SCOP Domain Sequences for d1ccr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccr__ a.3.1.1 (-) Mitochondrial cytochrome c {Rice embryos (Oryza sativa)}
asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats

SCOP Domain Coordinates for d1ccr__:

Click to download the PDB-style file with coordinates for d1ccr__.
(The format of our PDB-style files is described here.)

Timeline for d1ccr__: