Lineage for d1ccr__ (1ccr -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins) 
Protein Mitochondrial cytochrome c [46642] (5 species) 
Species Rice embryos (Oryza sativa) [TaxId:4530] [46645] (1 PDB entry) 
Domain d1ccr__: 1ccr - [15877]
Details for d1ccr__
PDB Entry: 1ccr (more details), 1.5 Å
PDB Description: structure of rice ferricytochrome c at 2.0 angstroms resolution
SCOP Domain Sequences for d1ccr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccr__ a.3.1.1 (-) Mitochondrial cytochrome c {Rice embryos (Oryza sativa)}
asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats
SCOP Domain Coordinates for d1ccr__:
Click to download the PDB-style file with coordinates for d1ccr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccr__:
- d1ccr__ first appeared (with stable ids) in SCOP 1.55
- d1ccr__ appears in SCOP 1.59
- d1ccr__ appears in the current release, SCOPe 2.08, called d1ccra_
View in 3D