Class a: All alpha proteins [46456] (179 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins) |
Protein Mitochondrial cytochrome c [46642] (5 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (15 PDB entries) |
Domain d1crcb_: 1crc B: [15868] complexed with hem |
PDB Entry: 1crc (more details), 2.08 Å
SCOP Domain Sequences for d1crcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crcb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Horse (Equus caballus)} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1crcb_: