Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (16 PDB entries) Uniprot P00004 |
Domain d1hrca_: 1hrc A: [15866] complexed with hem |
PDB Entry: 1hrc (more details), 1.9 Å
SCOP Domain Sequences for d1hrca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrca_ a.3.1.1 (A:) Mitochondrial cytochrome c {Horse (Equus caballus) [TaxId: 9796]} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1hrca_: