Class a: All alpha proteins [46456] (258 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (16 PDB entries) |
Domain d1wejf_: 1wej F: [15865] Other proteins in same PDB: d1wejh1, d1wejh2, d1wejl1, d1wejl2 complexed with ace, hem, zn |
PDB Entry: 1wej (more details), 1.8 Å
SCOP Domain Sequences for d1wejf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wejf_ a.3.1.1 (F:) Mitochondrial cytochrome c {Horse (Equus caballus) [TaxId: 9796]} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1wejf_:
View in 3D Domains from other chains: (mouse over for more information) d1wejh1, d1wejh2, d1wejl1, d1wejl2 |