SCOP 1.55: Domain d1yfc__: 1yfc -

Lineage for d1yfc__ (1yfc -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (5 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)

8. Domain d1yfc__: 1yfc - [15864]

Details for d1yfc__

PDB Entry: 1yfc

PDB Description: solution nmr structure of a yeast iso-1-ferrocytochrome c

SCOP Domain Sequences for d1yfc__:

Sequence, based on SEQRES records:

>d1yfc__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpxkyipgtkmafgglkkekdrndlitylkkase

Sequence, based on observed residues (ATOM records):

>d1yfc__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkyipgtkmafgglkkekdrndlitylkkase

Timeline for d1yfc__:

• d1yfc__ appears in SCOP 1.57
  
• d1yfc__ appears in the current release, SCOPe 2.08, called d1yfca_