Lineage for d1fhb__ (1fhb -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45125Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 45126Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)
  8. 45155Domain d1fhb__: 1fhb - [15862]

Details for d1fhb__

PDB Entry: 1fhb (more details)

PDB Description: three-dimensional solution structure of the cyanide adduct of a met80ala variant of saccharomyces cerevisiae iso-1-cytochrome c. identification of ligand-residue interactions in the distal heme cavity

SCOP Domain Sequences for d1fhb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhb__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrqsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkaafgglkkekdrndlitylkkase

SCOP Domain Coordinates for d1fhb__:

Click to download the PDB-style file with coordinates for d1fhb__.
(The format of our PDB-style files is described here.)

Timeline for d1fhb__: