SCOP 1.55: Domain d1fhb__: 1fhb -

Lineage for d1fhb__ (1fhb -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (5 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)

8. Domain d1fhb__: 1fhb - [15862]

Details for d1fhb__

PDB Entry: 1fhb

PDB Description: three-dimensional solution structure of the cyanide adduct of a met80ala variant of saccharomyces cerevisiae iso-1-cytochrome c. identification of ligand-residue interactions in the distal heme cavity

SCOP Domain Sequences for d1fhb__:

Sequence; same for both SEQRES and ATOM records:

>d1fhb__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrqsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkaafgglkkekdrndlitylkkase

Timeline for d1fhb__:

• d1fhb__ appears in SCOP 1.57
  
• d1fhb__ appears in the current release, SCOPe 2.08, called d1fhba_