SCOP 1.59: Domain d1rap__: 1rap -

Lineage for d1rap__ (1rap -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)

8. Domain d1rap__: 1rap - [15858]

Details for d1rap__

PDB Entry: 1rap, 2.25 Å

PDB Description: the structure and function of omega loop a replacements in cytochrome c

SCOP Domain Sequences for d1rap__:

Sequence; same for both SEQRES and ATOM records:

>d1rap__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtfdqggankvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

Timeline for d1rap__:

• d1rap__ first appeared (with stable ids) in SCOP 1.55
  
• d1rap__ appears in SCOP 1.57
  
• d1rap__ appears in SCOP 1.61
  
• d1rap__ appears in the current release, SCOPe 2.08, called d1rapa_