Lineage for d1rap__ (1rap -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1088Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 1093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)
  8. 1118Domain d1rap__: 1rap - [15858]

Details for d1rap__

PDB Entry: 1rap (more details), 2.25 Å

PDB Description: the structure and function of omega loop a replacements in cytochrome c

SCOP Domain Sequences for d1rap__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rap__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtfdqggankvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

SCOP Domain Coordinates for d1rap__:

Click to download the PDB-style file with coordinates for d1rap__.
(The format of our PDB-style files is described here.)

Timeline for d1rap__: