Lineage for d1irva_ (1irv A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719883Domain d1irva_: 1irv A: [15857]
    complexed with hem, so4; mutant

Details for d1irva_

PDB Entry: 1irv (more details), 1.9 Å

PDB Description: cytochrome c isozyme 1, reduced, mutant with ile 75 replaced by met and cys 102 replaced by thr
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1irva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irva_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkympgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d1irva_:

Click to download the PDB-style file with coordinates for d1irva_.
(The format of our PDB-style files is described here.)

Timeline for d1irva_: