SCOP 1.63: Domain d2ycc__: 2ycc -

Lineage for d2ycc__ (2ycc -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (32 PDB entries)

8. Domain d2ycc__: 2ycc - [15856]
   complexed with hem, so4, tml; mutant

Details for d2ycc__

PDB Entry: 2ycc, 1.9 Å

PDB Description: oxidation state-dependent conformational changes in cytochrome c

SCOP Domain Sequences for d2ycc__:

Sequence; same for both SEQRES and ATOM records:

>d2ycc__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d2ycc__:

• d2ycc__ first appeared (with stable ids) in SCOP 1.55
  
• d2ycc__ appears in SCOP 1.61
  
• d2ycc__ appears in SCOP 1.65
  
• d2ycc__ appears in the current release, SCOPe 2.08, called d2ycca_