Lineage for d1irw__ (1irw -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437826Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 437827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (35 PDB entries)
  8. 437851Domain d1irw__: 1irw - [15855]

Details for d1irw__

PDB Entry: 1irw (more details), 2 Å

PDB Description: cytochrome c isozyme 1, reduced, mutant with asn 52 replaced by ala and cys 102 replaced by thr

SCOP Domain Sequences for d1irw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irw__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaaikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOP Domain Coordinates for d1irw__:

Click to download the PDB-style file with coordinates for d1irw__.
(The format of our PDB-style files is described here.)

Timeline for d1irw__: