SCOP 1.73: Domain d1crga_: 1crg A:

Lineage for d1crga_ (1crg A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (39 PDB entries)

8. Domain d1crga_: 1crg A: [15854]
   complexed with hem, so4, tml; mutant

Details for d1crga_

PDB Entry: 1crg, 2 Å

PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c

PDB Compounds: (A:) cytochrome c

SCOP Domain Sequences for d1crga_:

Sequence; same for both SEQRES and ATOM records:

>d1crga_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d1crga_:

• d1crga_ first appeared (with stable ids) in SCOP 1.55, called d1crg__
  
• d1crga_ was called d1crg__ in SCOP 1.71
  
• d1crga_ appears in SCOP 1.75
  
• d1crga_ appears in the current release, SCOPe 2.08