Lineage for d1crg__ (1crg -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Mitochondrial cytochrome c [46642] (5 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries) 
Domain d1crg__: 1crg - [15854]
Details for d1crg__
PDB Entry: 1crg (more details), 2 Å
PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
SCOP Domain Sequences for d1crg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crg__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
SCOP Domain Coordinates for d1crg__:
Click to download the PDB-style file with coordinates for d1crg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1crg__:
- d1crg__ appears in SCOP 1.57
- d1crg__ appears in the current release, SCOPe 2.08, called d1crga_
View in 3D