| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mitochondrial cytochrome c [46642] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries) Uniprot P00044 |
| Domain d1cifa_: 1cif A: [15846] complexed with hem, so4; mutant |
PDB Entry: 1cif (more details), 1.9 Å
SCOPe Domain Sequences for d1cifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cifa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgahsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae
Timeline for d1cifa_: