Lineage for d1crja_ (1crj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304491Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. 2304569Domain d1crja_: 1crj A: [15842]
    complexed with hem, so4

Details for d1crja_

PDB Entry: 1crj (more details), 2.05 Å

PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1crja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crja_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d1crja_:

Click to download the PDB-style file with coordinates for d1crja_.
(The format of our PDB-style files is described here.)

Timeline for d1crja_: