Lineage for d1csw__ (1csw -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Mitochondrial cytochrome c [46642] (5 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries) 
Domain d1csw__: 1csw - [15839]
Details for d1csw__
PDB Entry: 1csw (more details), 1.9 Å
PDB Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c
SCOP Domain Sequences for d1csw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1csw__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafggmkkekdrndlitylkkate
SCOP Domain Coordinates for d1csw__:
Click to download the PDB-style file with coordinates for d1csw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1csw__:
- d1csw__ appears in SCOP 1.57
- d1csw__ appears in the current release, SCOPe 2.08, called d1cswa_
View in 3D