Lineage for d1cie__ (1cie -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94716Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 94717Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (30 PDB entries)
  8. 94722Domain d1cie__: 1cie - [15838]

Details for d1cie__

PDB Entry: 1cie (more details), 1.8 Å

PDB Description: structural and functional effects of multiple mutations at distal sites in cytochrome c

SCOP Domain Sequences for d1cie__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cie__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae

SCOP Domain Coordinates for d1cie__:

Click to download the PDB-style file with coordinates for d1cie__.
(The format of our PDB-style files is described here.)

Timeline for d1cie__: