Lineage for d1csua_ (1csu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691064Domain d1csua_: 1csu A: [15837]
    complexed with hec, so4

Details for d1csua_

PDB Entry: 1csu (more details), 1.81 Å

PDB Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1csua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csua_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafggckkekdrndlitylkkate

SCOPe Domain Coordinates for d1csua_:

Click to download the PDB-style file with coordinates for d1csua_.
(The format of our PDB-style files is described here.)

Timeline for d1csua_: