Lineage for d1ciha_ (1cih A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719859Domain d1ciha_: 1cih A: [15836]
    complexed with hem, so4; mutant

Details for d1ciha_

PDB Entry: 1cih (more details), 1.8 Å

PDB Description: structural and functional effects of multiple mutations at distal sites in cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1ciha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciha_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgahsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae

SCOPe Domain Coordinates for d1ciha_:

Click to download the PDB-style file with coordinates for d1ciha_.
(The format of our PDB-style files is described here.)

Timeline for d1ciha_: