SCOP 1.67: Domain d1cih__: 1cih -

Lineage for d1cih__ (1cih -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (34 PDB entries)

8. Domain d1cih__: 1cih - [15836]
   complexed with hem, so4, tml; mutant

Details for d1cih__

PDB Entry: 1cih, 1.8 Å

PDB Description: structural and functional effects of multiple mutations at distal sites in cytochrome c

SCOP Domain Sequences for d1cih__:

Sequence; same for both SEQRES and ATOM records:

>d1cih__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgahsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae

Timeline for d1cih__:

• d1cih__ first appeared (with stable ids) in SCOP 1.55
  
• d1cih__ appears in SCOP 1.65
  
• d1cih__ appears in SCOP 1.69
  
• d1cih__ appears in the current release, SCOPe 2.08, called d1ciha_