Class a: All alpha proteins [46456] (171 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
Protein Cytochrome c552 [46636] (5 species) |
Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries) |
Domain d1ql4a_: 1ql4 A: [15826] |
PDB Entry: 1ql4 (more details), 1.5 Å
SCOP Domain Sequences for d1ql4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ql4a_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans} adpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpea lqefltnpkavvkgtkmafaglpkiedranliaylegqq
Timeline for d1ql4a_: