![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c552 [46636] (6 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries) |
![]() | Domain d1ql3b_: 1ql3 B: [15823] complexed with hec |
PDB Entry: 1ql3 (more details), 1.4 Å
SCOPe Domain Sequences for d1ql3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ql3b_ a.3.1.1 (B:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]} adpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpea lqefltnpkavvkgtkmafaglpkiedranliaylegqq
Timeline for d1ql3b_: