SCOPe 2.07: Domain d3etjb1: 3etj B:277-355

Lineage for d3etjb1 (3etj B:277-355)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)

7. Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)

8. Domain d3etjb1: 3etj B:277-355 [158207]
   Other proteins in same PDB: d3etja2, d3etja3, d3etjb2, d3etjb3
   automated match to d1b6ra1
   complexed with adp, cl, mg, pi

Details for d3etjb1

PDB Entry: 3etj, 1.6 Å

PDB Description: crystal structure e. coli purk in complex with mg, adp, and pi

PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3etjb1:

Sequence; same for both SEQRES and ATOM records:

>d3etjb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

Timeline for d3etjb1:

• d3etjb1 first appeared in SCOP 1.75
  
• d3etjb1 appears in SCOPe 2.06
  
• d3etjb1 appears in the current release, SCOPe 2.08