Lineage for d3etjb1 (3etj B:277-355)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2426885Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2426969Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 2426970Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 2426972Domain d3etjb1: 3etj B:277-355 [158207]
    Other proteins in same PDB: d3etja2, d3etja3, d3etjb2, d3etjb3
    automated match to d1b6ra1
    complexed with adp, cl, mg, pi

Details for d3etjb1

PDB Entry: 3etj (more details), 1.6 Å

PDB Description: crystal structure e. coli purk in complex with mg, adp, and pi
PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3etjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etjb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOPe Domain Coordinates for d3etjb1:

Click to download the PDB-style file with coordinates for d3etjb1.
(The format of our PDB-style files is described here.)

Timeline for d3etjb1: