| Class b: All beta proteins [48724] (180 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species) |
| Species Escherichia coli [TaxId:562] [51253] (4 PDB entries) |
| Domain d3etjb1: 3etj B:277-355 [158207] Other proteins in same PDB: d3etja2, d3etja3, d3etjb2, d3etjb3 automated match to d1b6ra1 complexed with adp, cl, mg, pi |
PDB Entry: 3etj (more details), 1.6 Å
SCOPe Domain Sequences for d3etjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etjb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg
Timeline for d3etjb1: