![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
![]() | Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 [56072] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56073] (4 PDB entries) |
![]() | Domain d3etja3: 3etj A:79-276 [158206] Other proteins in same PDB: d3etja1, d3etja2, d3etjb1, d3etjb2 automated match to d1b6ra3 complexed with adp, cl, mg, pi |
PDB Entry: 3etj (more details), 1.6 Å
SCOPe Domain Sequences for d3etja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggydgrgqwrlrane teqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqa naqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisq felhlraitdlplpqpvv
Timeline for d3etja3: