| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species) |
| Species Escherichia coli [TaxId:562] [52447] (4 PDB entries) |
| Domain d3etja2: 3etj A:1-78 [158205] Other proteins in same PDB: d3etja1, d3etja3, d3etjb1, d3etjb3 automated match to d1b6ra2 complexed with adp, cl, mg, pi fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3etj (more details), 1.6 Å
SCOPe Domain Sequences for d3etja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia
Timeline for d3etja2: